General Information

  • ID:  hor006878
  • Uniprot ID:  P01588
  • Protein name:  Erythropoietin
  • Gene name:  NA
  • Organism:  Homo sapiens
  • Family:  EPO/TPO family
  • Source:  Human
  • Expression:  Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0044297 cell body; GO:0009986 cell surface; GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0030295 protein kinase activator activity; GO:0005179 hormone activity; GO:0005128 erythropoietin receptor binding; GO:0005125 cytokine activity
  • GO CC:  GO:0033189 response to vitamin A; GO:0043627 response to estrogen; GO:0043249 erythrocyte maturation; GO:0038162 erythropoietin-mediated signaling pathway; GO:0042541 hemoglobin biosynthetic process; GO:0033028 myeloid cell apoptotic process; GO:0010523 negative regulation of calcium ion transport into cytosol; GO:0007165 signal transduction; GO:2001258 negative regulation of cation channel activity; GO:1902251 negative regulation of erythrocyte apoptotic process; GO:1902219 negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress; GO:0001666 response to hypoxia; GO:0000122 negative regulation of transcription by RNA polymerase II; GO:0008284 positive regulation of cell population proliferation; GO:0045893 positive regulation of DNA-templated transcription; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0045666 positive regulation of neuron differentiation; GO:0010976 positive regulation of neuron projection development; GO:0046579 positiv

Sequence Information

  • Sequence:  PPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
  • Length:  165
  • Propeptide:  MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
  • Signal peptide:  MGVHECPAWLWLLLSLLSLPLGLPVLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA